Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGD Peptide - N-terminal region

PGD Peptide - N-terminal region

Product Specifications

Product Name Alternative

6PGD

UniProt

P52209

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGD Rabbit Polyclonal Antibody (orb585508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002622

Preservative

Lyophilized powder

AA Sequence

DFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Toll Like Receptor 5 (TLR5) ELISA Kit
EKN48867 96 Tests

Human Toll Like Receptor 5 (TLR5) ELISA Kit

Sign In for Pricing
View Details
M3KE19 antibody
70R-33268 100 µL

M3KE19 antibody

Sign In for Pricing
View Details
HNF1B Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-61983R-PerCP-Cy5.5 100 µL

HNF1B Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
2- (N'-Acetylhydrazino) -6-chloropyridine
sc-321119 250 mg

2- (N'-Acetylhydrazino) -6-chloropyridine

Sign In for Pricing
View Details
ZDHHC11 (NM_024786) Human Over-expression Lysate
LS079844-100ug 100 µg

ZDHHC11 (NM_024786) Human Over-expression Lysate

Sign In for Pricing
View Details
Prosc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37744114 3x 1.0 µg

Prosc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details