Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R Peptide - C-terminal region

MC1R Peptide - C-terminal region

Product Specifications

Product Name Alternative

CMM5, MGC14337, MSH-R, SHEP2

UniProt

Q01726

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MC1R Rabbit Polyclonal Antibody (orb585582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002377

Preservative

Lyophilized powder

AA Sequence

CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HB-EGF (H-1) Alexa Fluor® 647
sc-365182 AF647 200 µg/mL

HB-EGF (H-1) Alexa Fluor® 647

Sign In for Pricing
View Details
Lentiviral mouse Higd1c shRNA (UAS) - Lentiviral mouse Higd1c shRNA (UAS, RFP) (25)
GTR15207059 1 Vial

Lentiviral mouse Higd1c shRNA (UAS) - Lentiviral mouse Higd1c shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Lentiviral human SH2B3 sgRNA gene knockout kit - Lentiviral human SH2B3 sgRNA gene knockout kit (100)
GTR15371053 1 Vial

Lentiviral human SH2B3 sgRNA gene knockout kit - Lentiviral human SH2B3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
SRY MB-TET; 25 ug
45-6460-01 25 µg

SRY MB-TET; 25 ug

Sign In for Pricing
View Details
MKNK1 Antibody (Phospho-Thr255) : HRP (OAAF00461-HRP)
OAAF00461-100UG-HRP 100 µg

MKNK1 Antibody (Phospho-Thr255) : HRP (OAAF00461-HRP)

Sign In for Pricing
View Details
NPR1/NPRA, Human (Biotinylated, HEK293, His, Avi)
HY-P704143 1 Each

NPR1/NPRA, Human (Biotinylated, HEK293, His, Avi)

Sign In for Pricing
View Details