Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC1R Peptide - C-terminal region

MC1R Peptide - C-terminal region

Product Specifications

Product Name Alternative

CMM5, MGC14337, MSH-R, SHEP2

UniProt

Q01726

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MC1R Rabbit Polyclonal Antibody (orb585582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002377

Preservative

Lyophilized powder

AA Sequence

CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Klotho (KL) ELISA Kit
QY-E10264 96 Tests

Rat Klotho (KL) ELISA Kit

Sign In for Pricing
View Details
MSRB3 Protein, Human, Recombinant (His)
TMPY-00538-01 5 µg

MSRB3 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
MSRB3 Protein, Human, Recombinant (His)
TMPY-00538-02 10 µg

MSRB3 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
MSRB3 Protein, Human, Recombinant (His)
TMPY-00538-03 20 µg

MSRB3 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
MSRB3 Protein, Human, Recombinant (His)
TMPY-00538-04 50 µg

MSRB3 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
MSRB3 Protein, Human, Recombinant (His)
TMPY-00538-05 100 µg

MSRB3 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details