Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUTED Peptide - N-terminal region

MUTED Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686E2287, MU

UniProt

Q8TDH9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MUTED Rabbit Polyclonal Antibody (orb585591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_958437

Preservative

Lyophilized powder

AA Sequence

LSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucagon Trifluoroacetic Acid Salt
TRC-G412200-25MG 25 mg

Glucagon Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Cell Meter™ Colorimetric MTS Cell Proliferation Kit
22766-AAT 1000 Tests

Cell Meter™ Colorimetric MTS Cell Proliferation Kit

Sign In for Pricing
View Details
Human APH1A activation kit by CRISPRa
GA109571 1 Kit

Human APH1A activation kit by CRISPRa

Sign In for Pricing
View Details
LRRFIP2 (NM_001134369) Human Recombinant Protein
TP325687M 100 µg

LRRFIP2 (NM_001134369) Human Recombinant Protein

Sign In for Pricing
View Details
Rabies (Rab-50), CF740 conjugate, 0.1mg/mL
BNC740943-100 1x 100 µL

Rabies (Rab-50), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Mercaptopicolinic Acid Hydrochloride
TRC-M257000-500MG 500 mg

3-Mercaptopicolinic Acid Hydrochloride

Sign In for Pricing
View Details