Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUTED Peptide - N-terminal region

MUTED Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686E2287, MU

UniProt

Q8TDH9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MUTED Rabbit Polyclonal Antibody (orb585591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_958437

Preservative

Lyophilized powder

AA Sequence

LSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIF Antibody
R31108 100 µg

TRIF Antibody

Sign In for Pricing
View Details
KIAA0323 (KHNYN) Human Gene Knockout Kit (CRISPR)
KN206738RB 1 Kit

KIAA0323 (KHNYN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS507355 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
HSF1 pSer303 Rabbit Polyclonal Antibody
AP02511PU-N 100 µL

HSF1 pSer303 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tide Quencher™ 7.1 CPG [TQ7.1 CPG] *1000 Å*
2117-AAT 100 mg

Tide Quencher™ 7.1 CPG [TQ7.1 CPG] *1000 Å*

Sign In for Pricing
View Details
Vmn1r174 Mouse Gene Knockout Kit (CRISPR)
KN518965 1 Kit

Vmn1r174 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details