Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLN Peptide - N-terminal region

NLN Peptide - N-terminal region

Product Specifications

Product Name Alternative

AGTBP, DKFZp564F123, KIAA1226

UniProt

Q9BYT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NLN Rabbit Polyclonal Antibody (orb585594) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065777

Preservative

Lyophilized powder

AA Sequence

CLQALADVEVKYIVERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TEDC2 activation kit by CRISPRa
GA112853 1 Kit

Human TEDC2 activation kit by CRISPRa

Sign In for Pricing
View Details
MGP Mouse Monoclonal Antibody [Clone ID: OTI8D6]
CF806528 100 µg

MGP Mouse Monoclonal Antibody [Clone ID: OTI8D6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS628411 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Mouse Krt17 activation kit by CRISPRa
GA202371 1 Kit

Mouse Krt17 activation kit by CRISPRa

Sign In for Pricing
View Details
CF®488A Monoclonal Mouse Anti-6X His IgG, 1 mg/mL
#20228 1x 50 µL

CF®488A Monoclonal Mouse Anti-6X His IgG, 1 mg/mL

Sign In for Pricing
View Details
Mouse Fgf4 activation kit by CRISPRa
GA201402 1 Kit

Mouse Fgf4 activation kit by CRISPRa

Sign In for Pricing
View Details