Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLN Peptide - N-terminal region

NLN Peptide - N-terminal region

Product Specifications

Product Name Alternative

AGTBP, DKFZp564F123, KIAA1226

UniProt

Q9BYT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NLN Rabbit Polyclonal Antibody (orb585594) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065777

Preservative

Lyophilized powder

AA Sequence

CLQALADVEVKYIVERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(1,3-benzodioxol-5-yl)-2-(1-pyrrolidinyl)-1-Hexanone hydrochloride
TRC-B227110-25MG 25 mg

1-(1,3-benzodioxol-5-yl)-2-(1-pyrrolidinyl)-1-Hexanone hydrochloride

Sign In for Pricing
View Details
3-Aminorifamycin S (Technical Grade)
TRC-A629273-2.5MG 2.5 mg

3-Aminorifamycin S (Technical Grade)

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559588 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
CDSN Antibody
OC-747-01 50 μL

CDSN Antibody

Sign In for Pricing
View Details
CDSN Antibody
OC-747-02 100 µL

CDSN Antibody

Sign In for Pricing
View Details
CDSN Antibody
OC-747-03 1 mL

CDSN Antibody

Sign In for Pricing
View Details