Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VKORC1 Peptide - C-terminal region

VKORC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EDTP308, FLJ00289, IMAGE3455200, MGC2694, MST134, MST576, VKCFD2, VKOR

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VKORC1 Rabbit Polyclonal Antibody (orb585602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

LHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r96 CRISPR Activation Plasmid (m2)
sc-436620-ACT-2 20 µg

Vmn2r96 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
SETD2 Knockout Cell Lysate
ABC-KC1802 100 µg

SETD2 Knockout Cell Lysate

Sign In for Pricing
View Details
FAM171A2-set siRNA/shRNA/RNAi Lentivector (Human)
19835091 4x 500 ng

FAM171A2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ACTH (Adrenocorticotropic Hormone, Adrenocorticotropin) (APC) discontinued
A9025-03G-APC 100 µL

ACTH (Adrenocorticotropic Hormone, Adrenocorticotropin) (APC) discontinued

Sign In for Pricing
View Details
CTSL1 Antibody
GWB-MW817G 50 µg

CTSL1 Antibody

Sign In for Pricing
View Details
ZNF669 Overexpression Lysate (Native) - (Dry Ice)
NBL1-18220 0.1 mg

ZNF669 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details