Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VKORC1 Peptide - C-terminal region

VKORC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EDTP308, FLJ00289, IMAGE3455200, MGC2694, MST134, MST576, VKCFD2, VKOR

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VKORC1 Rabbit Polyclonal Antibody (orb585602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

LHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ARL8B shRNA (UAS) - Lentiviral human ARL8B shRNA (UAS) (25)
GTR15117041 1 Vial

Lentiviral human ARL8B shRNA (UAS) - Lentiviral human ARL8B shRNA (UAS) (25)

Sign In for Pricing
View Details
Cis-4-Phenylpiperidine-3-carboxylic acid, N-BOC protected
sc-358098 250 mg

Cis-4-Phenylpiperidine-3-carboxylic acid, N-BOC protected

Sign In for Pricing
View Details
Syntaxin 12 (Syntaxin-12, STX12)
134025 50 µg

Syntaxin 12 (Syntaxin-12, STX12)

Sign In for Pricing
View Details
Gvin1 CRISPR/Cas9 KO Plasmid (m)
sc-428926 20 µg

Gvin1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human Acyl-Protein Thioesterase 1/APT-1 (N-6His)
orb1649577-01 10 µg

Recombinant Human Acyl-Protein Thioesterase 1/APT-1 (N-6His)

Sign In for Pricing
View Details
Recombinant Human Acyl-Protein Thioesterase 1/APT-1 (N-6His)
orb1649577-02 50 µg

Recombinant Human Acyl-Protein Thioesterase 1/APT-1 (N-6His)

Sign In for Pricing
View Details