Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF5 Peptide - N-terminal region

GDF5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BMP14, CDMP1, LAP4, OS5, SYNS2

UniProt

P43026

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GDF5 Rabbit Polyclonal Antibody (orb585603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000548

Preservative

Lyophilized powder

AA Sequence

YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM Biotin Antibody Labeling Kit, 1x (20-50ug) labeling
#92266 1 Kit

Mix-n-StainTM Biotin Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
C4A Antibody
KC-430-01 50 μL

C4A Antibody

Sign In for Pricing
View Details
C4A Antibody
KC-430-02 100 µL

C4A Antibody

Sign In for Pricing
View Details
C4A Antibody
KC-430-03 1 mL

C4A Antibody

Sign In for Pricing
View Details
VIC Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*
67002-AAT 1 Plate

VIC Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*

Sign In for Pricing
View Details
STAT5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H9]
TA502813AM 100 µL

STAT5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H9]

Sign In for Pricing
View Details