Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD82 Peptide - C-terminal region

CD82 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4F9, C33, GR15, IA4, KAI1, R2, SAR2, ST6, TSPAN27

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD82 Rabbit Polyclonal Antibody (orb585613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

ELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7 (NM_000971) Human Over-expression Lysate
LC424418 20 µg

RPL7 (NM_000971) Human Over-expression Lysate

Sign In for Pricing
View Details
NSE2 (NSMCE2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A2]
TA501632AM 100 µL

NSE2 (NSMCE2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A2]

Sign In for Pricing
View Details
Human PMP2 activation kit by CRISPRa
GA103629 1 Kit

Human PMP2 activation kit by CRISPRa

Sign In for Pricing
View Details
General Purpose Incubator BIGP-6201
BIGP-6201 1 Unit

General Purpose Incubator BIGP-6201

Sign In for Pricing
View Details
SUPT16H (321-640) Rabbit Polyclonal Antibody
AP07880PU-N 50 µg

SUPT16H (321-640) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pro-Gln-OH
TRC-P839998-10MG 10 mg

Pro-Gln-OH

Sign In for Pricing
View Details