CD82 Peptide - C-terminal region
CD82 Peptide - C-terminal region
Product Specifications
Product Name Alternative
4F9, C33, GR15, IA4, KAI1, R2, SAR2, ST6, TSPAN27
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD82 Rabbit Polyclonal Antibody (orb585613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
ELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC883530-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3530), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 