Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD274 Peptide - N-terminal region

CD274 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B7-H, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1

UniProt

Q9NZQ7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD274 Rabbit Polyclonal Antibody (orb585615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_054862

Preservative

Lyophilized powder

AA Sequence

HLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP3/H-FABP Polyclonal Antibody, FITC Conjugated
bs-41180R-FITC 100 µL

FABP3/H-FABP Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
FepD Antibody
orb814483 2 mg

FepD Antibody

Sign In for Pricing
View Details
Recombinant Human NFKB Inhibitor Interacting Ras-Like 2
MBS145396-01 0.002 mg

Recombinant Human NFKB Inhibitor Interacting Ras-Like 2

Sign In for Pricing
View Details
Recombinant Human NFKB Inhibitor Interacting Ras-Like 2
MBS145396-02 0.01 mg

Recombinant Human NFKB Inhibitor Interacting Ras-Like 2

Sign In for Pricing
View Details
Recombinant Human NFKB Inhibitor Interacting Ras-Like 2
MBS145396-03 1 mg

Recombinant Human NFKB Inhibitor Interacting Ras-Like 2

Sign In for Pricing
View Details
Recombinant Human NFKB Inhibitor Interacting Ras-Like 2
MBS145396-04 5x 1 mg

Recombinant Human NFKB Inhibitor Interacting Ras-Like 2

Sign In for Pricing
View Details