Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD274 Peptide - N-terminal region

CD274 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B7-H, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1

UniProt

Q9NZQ7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD274 Rabbit Polyclonal Antibody (orb585615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_054862

Preservative

Lyophilized powder

AA Sequence

HLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Agfg1 shRNA (UAS) - Lentiviral mouseAgfg1 shRNA (UAS, GFP) (25)
GTR15219284 1 Vial

Lentiviral mouse Agfg1 shRNA (UAS) - Lentiviral mouseAgfg1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FAM107B CRISPR/Cas9 KO Plasmid (h)
sc-410178 20 µg

FAM107B CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Camk2g (NM_178597) Mouse Tagged Lenti ORF Clone
MR224391L4 10 µg

Camk2g (NM_178597) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AVPR1B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV657333 1.0 µg DNA

AVPR1B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
IKAROS/IKZF1 Antibody
orb20354 100 µg

IKAROS/IKZF1 Antibody

Sign In for Pricing
View Details
ZBTB24 Recombinant Protein (Mouse)
RP186194 100 µg

ZBTB24 Recombinant Protein (Mouse)

Sign In for Pricing
View Details