Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRMS Peptide - C-terminal region

SRMS Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf148, SRM, dJ697K14.1

UniProt

Q9H3Y6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRMS Rabbit Polyclonal Antibody (orb585626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_543013

Preservative

Lyophilized powder

AA Sequence

QQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycerol 3 phosphate permease (SLC37A1) (NM_018964) Human Over-expression Lysate
LS054020-20ug 20 µg

Glycerol 3 phosphate permease (SLC37A1) (NM_018964) Human Over-expression Lysate

Sign In for Pricing
View Details
Glucoscillaren A
orb1990541-01 1 mg

Glucoscillaren A

Sign In for Pricing
View Details
Glucoscillaren A
orb1990541-02 5 mg

Glucoscillaren A

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD38 Antibody
JOT22714F 20Tests

PE/Cyanine7 Anti-Mouse CD38 Antibody

Sign In for Pricing
View Details
GTF2A1L Antibody
orb1327511 100 µg

GTF2A1L Antibody

Sign In for Pricing
View Details
DEFB106B Human Over-expression Lysate
orb1364416 20 µg

DEFB106B Human Over-expression Lysate

Sign In for Pricing
View Details