Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRMS Peptide - C-terminal region

SRMS Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf148, SRM, dJ697K14.1

UniProt

Q9H3Y6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRMS Rabbit Polyclonal Antibody (orb585626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_543013

Preservative

Lyophilized powder

AA Sequence

QQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dyrk2 Antibody (C-term) Blocking peptide
MBS9220434-01 0.5 mg

Mouse Dyrk2 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
Mouse Dyrk2 Antibody (C-term) Blocking peptide
MBS9220434-02 5x 0.5 mg

Mouse Dyrk2 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
Anti-PD-1 Antibody-PerCP (5M150)
TMAY-00718C-01 25 Tests

Anti-PD-1 Antibody-PerCP (5M150)

Sign In for Pricing
View Details
Anti-PD-1 Antibody-PerCP (5M150)
TMAY-00718C-02 100 Tests

Anti-PD-1 Antibody-PerCP (5M150)

Sign In for Pricing
View Details
Mouse Prkcq Antibody (Center)
orb1925253-01 50 µL

Mouse Prkcq Antibody (Center)

Sign In for Pricing
View Details
Mouse Prkcq Antibody (Center)
orb1925253-02 100 µL

Mouse Prkcq Antibody (Center)

Sign In for Pricing
View Details