Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAZ Peptide - middle region

TAZ Peptide - middle region

Product Specifications

Product Name Alternative

BTHS, CMD3A, EFE, EFE2, FLJ27390, G4.5, LVNCX, Taz1, XAP-2

UniProt

Q16635

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAZ Rabbit Polyclonal Antibody (orb331226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_851828

Preservative

Lyophilized powder

AA Sequence

PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Hydroxypipecolic acid
MBS3613021-01 2 mg

N-Hydroxypipecolic acid

Sign In for Pricing
View Details
N-Hydroxypipecolic acid
MBS3613021-02 5 mg

N-Hydroxypipecolic acid

Sign In for Pricing
View Details
N-Hydroxypipecolic acid
MBS3613021-03 10 mg

N-Hydroxypipecolic acid

Sign In for Pricing
View Details
N-Hydroxypipecolic acid
MBS3613021-04 50 mg

N-Hydroxypipecolic acid

Sign In for Pricing
View Details
N-Hydroxypipecolic acid
MBS3613021-05 100 mg

N-Hydroxypipecolic acid

Sign In for Pricing
View Details
N-Hydroxypipecolic acid
MBS3613021-06 5x 100 mg

N-Hydroxypipecolic acid

Sign In for Pricing
View Details