Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT2 Peptide - C-terminal region

CCT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

99D8.1, CCT-beta, CCTB, MGC142074, MGC142076, PRO1633, TCP-1-beta

UniProt

P78371

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCT2 Rabbit Polyclonal Antibody (orb331228) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006422

Preservative

Lyophilized powder

AA Sequence

RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTN1 Antibody
PT-A00076-01 5 µg

ACTN1 Antibody

Sign In for Pricing
View Details
ACTN1 Antibody
PT-A00076-02 20 µg

ACTN1 Antibody

Sign In for Pricing
View Details
ACTN1 Antibody
PT-A00076-03 100 µg

ACTN1 Antibody

Sign In for Pricing
View Details
Otud5 sgRNA CRISPR Lentivector set (Mouse)
K4767101 3x 1.0 µg

Otud5 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Bitolterol Mesylate
162911 25 mg

Bitolterol Mesylate

Sign In for Pricing
View Details
PROSER2 Human shRNA Plasmid Kit (Locus ID 254427)
TL306312 1 Kit

PROSER2 Human shRNA Plasmid Kit (Locus ID 254427)

Sign In for Pricing
View Details