Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT2 Peptide - C-terminal region

CCT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

99D8.1, CCT-beta, CCTB, MGC142074, MGC142076, PRO1633, TCP-1-beta

UniProt

P78371

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCT2 Rabbit Polyclonal Antibody (orb331228) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006422

Preservative

Lyophilized powder

AA Sequence

RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC8 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62393R-BF405 100 µL

ERCC8 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
GFRα-1 Polyclonal Antibody
ABP54514-01 30 µL

GFRα-1 Polyclonal Antibody

Sign In for Pricing
View Details
GFRα-1 Polyclonal Antibody
ABP54514-02 100 µL

GFRα-1 Polyclonal Antibody

Sign In for Pricing
View Details
GFRα-1 Polyclonal Antibody
ABP54514-03 200 µL

GFRα-1 Polyclonal Antibody

Sign In for Pricing
View Details
SirReal-1
T24790-01 25 mg

SirReal-1

Sign In for Pricing
View Details
SirReal-1
T24790-02 50 mg

SirReal-1

Sign In for Pricing
View Details