Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A5 Peptide - N-terminal region

SLC22A5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDSP, FLJ46769, OCTN2, OCTN2VT

UniProt

O76082

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A5 Rabbit Polyclonal Antibody (orb585632) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003051

Preservative

Lyophilized powder

AA Sequence

TLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXR1 Recombinant Rabbit Monoclonal Antibody [PSH01-67]
HA721710 100 µL

FXR1 Recombinant Rabbit Monoclonal Antibody [PSH01-67]

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS701926 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Tropine-3-thiol Hydrochloride
TRC-T892675-25G 25 g

Tropine-3-thiol Hydrochloride

Sign In for Pricing
View Details
Recombinant DBF4 Antibody
RC-4890-01 50 μL

Recombinant DBF4 Antibody

Sign In for Pricing
View Details
Recombinant DBF4 Antibody
RC-4890-02 100 µL

Recombinant DBF4 Antibody

Sign In for Pricing
View Details
Recombinant DBF4 Antibody
RC-4890-03 1 mL

Recombinant DBF4 Antibody

Sign In for Pricing
View Details