Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A5 Peptide - N-terminal region

SLC22A5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDSP, FLJ46769, OCTN2, OCTN2VT

UniProt

O76082

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A5 Rabbit Polyclonal Antibody (orb585632) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003051

Preservative

Lyophilized powder

AA Sequence

TLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Deiodinase, Iodothyronine, Type I (DIO1) ELISA Kit
RDR-DIO1-Ra-01 96 Tests

Rat Deiodinase, Iodothyronine, Type I (DIO1) ELISA Kit

Sign In for Pricing
View Details
Rat Deiodinase, Iodothyronine, Type I (DIO1) ELISA Kit
RDR-DIO1-Ra-02 48 Tests

Rat Deiodinase, Iodothyronine, Type I (DIO1) ELISA Kit

Sign In for Pricing
View Details
4-Benzyloxybenzoic Acid
TRC-B287825-5G 5 g

4-Benzyloxybenzoic Acid

Sign In for Pricing
View Details
Human PCCA activation kit by CRISPRa
GA103406 1 Kit

Human PCCA activation kit by CRISPRa

Sign In for Pricing
View Details
Protein G Coated - 96 well Solid plates - White PS
MCW09F-PG 10x 96 Well Plates

Protein G Coated - 96 well Solid plates - White PS

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/903), CF405S conjugate, 0.1mg/mL
BNC040903-500 1x 500 µL

Cytokeratin 7 (KRT7/903), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details