IL13RA1 Peptide - C-terminal region
IL13RA1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD213A1, IL-13Ra, NR4
UniProt
P78552
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL13RA1 Rabbit Polyclonal Antibody (orb585635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001551
Preservative
Lyophilized powder
AA Sequence
VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740525-500 1x 500 µL
CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681486-100 1x 100 µL
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details