Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPC Peptide - C-terminal region

LIPC Peptide - C-terminal region

Product Specifications

Product Name Alternative

HDLCQ12, HL, HTGL, LIPH

UniProt

P11150

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPC Rabbit Polyclonal Antibody (orb585649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000227

Preservative

Lyophilized powder

AA Sequence

LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Clusterin CF
2937-HS-050 50 µg

Recombinant Human Clusterin CF

Sign In for Pricing
View Details
Phospho-TGF beta Receptor II (Ser225) Rabbit pAb
E47R18067 100 µL

Phospho-TGF beta Receptor II (Ser225) Rabbit pAb

Sign In for Pricing
View Details
Human GEMIN6 Knockout A549 cell line
GTR15404594 1 Vial

Human GEMIN6 Knockout A549 cell line

Sign In for Pricing
View Details
ZNF507 (NM_001136156) Human Over-expression Lysate
LS022847-20ug 20 µg

ZNF507 (NM_001136156) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Chloro-1-{4-[ (4-methoxyphenyl) methyl]-1,4-diazepan-1-yl}ethan-1-one hydrochloride
NAC27514-01 50 mg

2-Chloro-1-{4-[ (4-methoxyphenyl) methyl]-1,4-diazepan-1-yl}ethan-1-one hydrochloride

Sign In for Pricing
View Details
2-Chloro-1-{4-[ (4-methoxyphenyl) methyl]-1,4-diazepan-1-yl}ethan-1-one hydrochloride
NAC27514-02 0.5 g

2-Chloro-1-{4-[ (4-methoxyphenyl) methyl]-1,4-diazepan-1-yl}ethan-1-one hydrochloride

Sign In for Pricing
View Details