Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100b Peptide - N-terminal region

S100b Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC93559, S100P

UniProt

P04631

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100b Rabbit Polyclonal Antibody (orb574858) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037323

Preservative

Lyophilized powder

AA Sequence

KLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tusc3 (NM_001004212) Rat Tagged Lenti ORF Clone
RR202067L3 10 µg

Tusc3 (NM_001004212) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SET antibody
MBS9401726-01 0.05 mL

SET antibody

Sign In for Pricing
View Details
SET antibody
MBS9401726-02 0.1 mL

SET antibody

Sign In for Pricing
View Details
SET antibody
MBS9401726-03 5x 0.1 mL

SET antibody

Sign In for Pricing
View Details
Wilforine
361894 10 mg

Wilforine

Sign In for Pricing
View Details
1-Naphthalene Acetic Acid 95.0%
029298-01 25 g

1-Naphthalene Acetic Acid 95.0%

Sign In for Pricing
View Details