Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100b Peptide - N-terminal region

S100b Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC93559, S100P

UniProt

P04631

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100b Rabbit Polyclonal Antibody (orb574858) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037323

Preservative

Lyophilized powder

AA Sequence

KLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SUMO3 sgRNA gene knockout kit - Lentiviral human SUMO3 sgRNA gene knockout kit (100)
GTR15373039 1 Vial

Lentiviral human SUMO3 sgRNA gene knockout kit - Lentiviral human SUMO3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Rat Heat Shock 70kDa Protein 5 (HSPA5/GRP78) ELISA kit
201-11-0992 96 Tests

Rat Heat Shock 70kDa Protein 5 (HSPA5/GRP78) ELISA kit

Sign In for Pricing
View Details
Human Gla- rich protein, GRP ELISA KIT
E6794Hu-01 48 Well

Human Gla- rich protein, GRP ELISA KIT

Sign In for Pricing
View Details
Human Gla- rich protein, GRP ELISA KIT
E6794Hu-02 96 Well

Human Gla- rich protein, GRP ELISA KIT

Sign In for Pricing
View Details
Human Gla- rich protein, GRP ELISA KIT
E6794Hu-03 5x 96 Tests

Human Gla- rich protein, GRP ELISA KIT

Sign In for Pricing
View Details
Human Gla- rich protein, GRP ELISA KIT
E6794Hu-04 10x 96 Tests

Human Gla- rich protein, GRP ELISA KIT

Sign In for Pricing
View Details