Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldb2 Peptide - N-terminal region

Ldb2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI035351, AW146358, CLIM1, CLP-36, Ldb3

UniProt

O55203

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ldb2 Rabbit Polyclonal Antibody (orb576494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034828

Preservative

Lyophilized powder

AA Sequence

MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEBPA Peptide
MBS3225390-01 0.1 mg

CEBPA Peptide

Sign In for Pricing
View Details
CEBPA Peptide
MBS3225390-02 5x 0.1 mg

CEBPA Peptide

Sign In for Pricing
View Details
Entpd6 Rat shRNA Lentiviral Particle (Locus ID 85260)
TL711906V 500 µL Each

Entpd6 Rat shRNA Lentiviral Particle (Locus ID 85260)

Sign In for Pricing
View Details
CdcA1 (E-6) : m-IgG1 BP-HRP Bundle
sc-543354 1 Kit

CdcA1 (E-6) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
PLP2 Rabbit pAb, PE-Cy5.5 conjugated
orb2882807 100 µL

PLP2 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Dcn Antibody, HRP conjugated
A19040-50UG 50 µg

Dcn Antibody, HRP conjugated

Sign In for Pricing
View Details