Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldb2 Peptide - N-terminal region

Ldb2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI035351, AW146358, CLIM1, CLP-36, Ldb3

UniProt

O55203

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ldb2 Rabbit Polyclonal Antibody (orb576494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034828

Preservative

Lyophilized powder

AA Sequence

MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGFR-β (phospho Tyr751) Polyclonal Antibody
13622-01 50 µL

PDGFR-β (phospho Tyr751) Polyclonal Antibody

Sign In for Pricing
View Details
PDGFR-β (phospho Tyr751) Polyclonal Antibody
13622-02 100 µL

PDGFR-β (phospho Tyr751) Polyclonal Antibody

Sign In for Pricing
View Details
UBTF Antibody
orb675915-01 50 µg

UBTF Antibody

Sign In for Pricing
View Details
UBTF Antibody
orb675915-02 100 µg

UBTF Antibody

Sign In for Pricing
View Details
ZNF620 Recombinant Protein Antigen
NBP2-68752PEP 100 µL

ZNF620 Recombinant Protein Antigen

Sign In for Pricing
View Details
AZD2423
HY-135891-01 5 mg

AZD2423

Sign In for Pricing
View Details