Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmo3 Peptide - N-terminal region

Lmo3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI854781, BB106490, Rbtn-3, Rbtn3

UniProt

Q8BZL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmo3 Rabbit Polyclonal Antibody (orb576542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997105

Preservative

Lyophilized powder

AA Sequence

PKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Platelet Basic Protein, CT (PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, CXCL7, Small-inducible Cytokine B7)
MBS649260-01 0.2 mL

Platelet Basic Protein, CT (PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, CXCL7, Small-inducible Cytokine B7)

Sign In for Pricing
View Details
Platelet Basic Protein, CT (PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, CXCL7, Small-inducible Cytokine B7)
MBS649260-02 5x 0.2 mL

Platelet Basic Protein, CT (PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, CXCL7, Small-inducible Cytokine B7)

Sign In for Pricing
View Details
Fcho1 (NM_001106069) Rat Untagged Clone
RN206260 10 µg

Fcho1 (NM_001106069) Rat Untagged Clone

Sign In for Pricing
View Details
PTH Mouse mAb, Biotin conjugated
orb3165011-01 1 Each

PTH Mouse mAb, Biotin conjugated

Sign In for Pricing
View Details
PTH Mouse mAb, Biotin conjugated
orb3165011-02 100 µL

PTH Mouse mAb, Biotin conjugated

Sign In for Pricing
View Details
CD8B Protein Lysate
OCOA20953-20UG 20 µg

CD8B Protein Lysate

Sign In for Pricing
View Details