Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmo3 Peptide - N-terminal region

Lmo3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI854781, BB106490, Rbtn-3, Rbtn3

UniProt

Q8BZL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmo3 Rabbit Polyclonal Antibody (orb576542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997105

Preservative

Lyophilized powder

AA Sequence

PKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPP3 (KIAA0391) (NM_014672) Human Over-expression Lysate
LS009692-20ug 20 µg

MRPP3 (KIAA0391) (NM_014672) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse Adipolin (C1QTNF12)
CSB-EP840280MO-01 10 µg

Recombinant Mouse Adipolin (C1QTNF12)

Sign In for Pricing
View Details
Recombinant Mouse Adipolin (C1QTNF12)
CSB-EP840280MO-02 50 µg

Recombinant Mouse Adipolin (C1QTNF12)

Sign In for Pricing
View Details
Recombinant Mouse Adipolin (C1QTNF12)
CSB-EP840280MO-03 200 µg

Recombinant Mouse Adipolin (C1QTNF12)

Sign In for Pricing
View Details
Recombinant Mouse Adipolin (C1QTNF12)
CSB-EP840280MO-04 500 µg

Recombinant Mouse Adipolin (C1QTNF12)

Sign In for Pricing
View Details
Recombinant Mouse Adipolin (C1QTNF12)
CSB-EP840280MO-05 20 µg

Recombinant Mouse Adipolin (C1QTNF12)

Sign In for Pricing
View Details