Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif5 Peptide - C-terminal region

Eif5 Peptide - C-terminal region

Product Specifications

UniProt

Q07205

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif5 Rabbit Polyclonal Antibody (orb576553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064460

Preservative

Lyophilized powder

AA Sequence

VKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKTASVPKVETVKSDNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Citatuzumab bogatox Antibody
orb1980644-01 5 mg

Citatuzumab bogatox Antibody

Sign In for Pricing
View Details
Citatuzumab bogatox Antibody
orb1980644-02 50 mg

Citatuzumab bogatox Antibody

Sign In for Pricing
View Details
Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit
MBS453412-01 48 Tests

Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit

Sign In for Pricing
View Details
Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit
MBS453412-02 96 Tests

Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit

Sign In for Pricing
View Details
Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit
MBS453412-03 5x 96 Tests

Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit

Sign In for Pricing
View Details
Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit
MBS453412-04 10x 96 Tests

Rat Glucose-6-Phosphatase, Catalytic (G6PC) ELISA Kit

Sign In for Pricing
View Details