Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif5 Peptide - C-terminal region

Eif5 Peptide - C-terminal region

Product Specifications

UniProt

Q07205

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif5 Rabbit Polyclonal Antibody (orb576553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064460

Preservative

Lyophilized powder

AA Sequence

VKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKTASVPKVETVKSDNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1139 Protein Vector (Rat) (pPM-C-His)
PV287217 500 ng

Olr1139 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
P4HA3 Protein Vector (Rat) (pPM-C-His)
PV292137 500 ng

P4HA3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
NAPA Antibody
MBS7124279-01 0.05 mL

NAPA Antibody

Sign In for Pricing
View Details
NAPA Antibody
MBS7124279-02 0.1 mL

NAPA Antibody

Sign In for Pricing
View Details
NAPA Antibody
MBS7124279-03 5x 0.1 mL

NAPA Antibody

Sign In for Pricing
View Details
Lentiviral mouse En1 shRNA (UAS) - Lentiviral mouse En1 shRNA (UAS, GFP) (100)
GTR15265101 1 Vial

Lentiviral mouse En1 shRNA (UAS) - Lentiviral mouse En1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details