Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfkbil1 Peptide - C-terminal region

Nfkbil1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Def-7, IKBL

UniProt

O88995

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nfkbil1 Rabbit Polyclonal Antibody (orb576727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035039

Preservative

Lyophilized powder

AA Sequence

RGPPLEEQGALKRYLRVQQVRWHPDRFLQRFRSQIETWELGRVMGAVTAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INSC Human Gene Knockout Kit (CRISPR)
KN415747 1 Kit

INSC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
11-(4-Ethyl-1-piperazinyl)-dibenzo[b,f][1,4]thiazepine-D5 Dihydrochloride
TRC-E925792-5MG 5 mg

11-(4-Ethyl-1-piperazinyl)-dibenzo[b,f][1,4]thiazepine-D5 Dihydrochloride

Sign In for Pricing
View Details
Pcbd2 (BC028642) Mouse Tagged ORF Clone
MG200340 10 µg

Pcbd2 (BC028642) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ZDHHC11 (NM_024786) Human Recombinant Protein
TP304383L 1 mg

ZDHHC11 (NM_024786) Human Recombinant Protein

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), CF488A conjugate, 0.1mg/mL
BNC882477-500 1x 500 µL

MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SKAP55 (SKAP1) (NM_001075099) Human Over-expression Lysate
LC421351 20 µg

SKAP55 (SKAP1) (NM_001075099) Human Over-expression Lysate

Sign In for Pricing
View Details