Nfkbil1 Peptide - C-terminal region
Nfkbil1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Def-7, IKBL
UniProt
O88995
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Nfkbil1 Rabbit Polyclonal Antibody (orb576727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_035039
Preservative
Lyophilized powder
AA Sequence
RGPPLEEQGALKRYLRVQQVRWHPDRFLQRFRSQIETWELGRVMGAVTAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA423929 100 µL
Retinoid X Receptor alpha (RXRA) Rabbit Monoclonal Antibody
Sign In for Pricing
View Details 
BNC041907-100 1x 100 µL
STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401486-500 1x 500 µL
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 