Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5C Peptide - C-terminal region

NT5C Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNT, DNT1, P5N2, PN-I, PN-II, UMPH2, cdN, dNT-1

UniProt

Q8TCD5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NT5C Rabbit Polyclonal Antibody (orb576970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_055410

Preservative

Lyophilized powder

AA Sequence

QEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGP 9.5 Polyclonal Antibody
E-AB-70268-01 60 µL

PGP 9.5 Polyclonal Antibody

Sign In for Pricing
View Details
PGP 9.5 Polyclonal Antibody
E-AB-70268-02 120 µL

PGP 9.5 Polyclonal Antibody

Sign In for Pricing
View Details
PGP 9.5 Polyclonal Antibody
E-AB-70268-03 200 µL

PGP 9.5 Polyclonal Antibody

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF640R conjugate, 0.1mg/mL
BNC400700-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560014 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
2-Acetamido-2-deoxy-N-[N-(benzyloxycarbonyl)-Epsilon-aminocaproyl]-Beta-D-glucopyranosylamine
TRC-A151050-10MG 10 mg

2-Acetamido-2-deoxy-N-[N-(benzyloxycarbonyl)-Epsilon-aminocaproyl]-Beta-D-glucopyranosylamine

Sign In for Pricing
View Details