Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5C Peptide - C-terminal region

NT5C Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNT, DNT1, P5N2, PN-I, PN-II, UMPH2, cdN, dNT-1

UniProt

Q8TCD5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NT5C Rabbit Polyclonal Antibody (orb576970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_055410

Preservative

Lyophilized powder

AA Sequence

QEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ADAR1 Antibody
RC-6847-01 50 μL

Recombinant ADAR1 Antibody

Sign In for Pricing
View Details
Recombinant ADAR1 Antibody
RC-6847-02 100 µL

Recombinant ADAR1 Antibody

Sign In for Pricing
View Details
Recombinant ADAR1 Antibody
RC-6847-03 1 mL

Recombinant ADAR1 Antibody

Sign In for Pricing
View Details
5-Benzamidolevulinic Acid
TRC-B184950-250MG 250 mg

5-Benzamidolevulinic Acid

Sign In for Pricing
View Details
Biotin Conjugated Goat Polyclonal Antibody to Human Albumin
BAT-2113-2 2 mL

Biotin Conjugated Goat Polyclonal Antibody to Human Albumin

Sign In for Pricing
View Details
PRMT1 Antibody
KC-6116-01 50 μL

PRMT1 Antibody

Sign In for Pricing
View Details