Kbtbd5 Peptide - N-terminal region
Kbtbd5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
2310024D23Rik, Kbtbd5
UniProt
Q9D783
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Kbtbd5 Rabbit Polyclonal Antibody (orb577336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_082478
Preservative
Lyophilized powder
AA Sequence
LGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRVGEREFPCHRLVLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040236-100 1x 100 µL
Progesterone (6-5E-3F), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![4-[2,2-Dichloro-1-(4-hydroxyphenyl)ethenyl]phenol](https://cdn.genprice.uk/products/572/8609638856025/imageurl/trc-d438908-50mg.webp)
TRC-D438908-50MG 50 mg
4-[2,2-Dichloro-1-(4-hydroxyphenyl)ethenyl]phenol
Sign In for Pricing
View Details 
BNC403772-100 1x 100 µL
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/3772R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882257-500 1x 500 µL
Glucose 6-Phosphate Isomerase (CPTC-GPI-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RDR-Bax-Hu-01 96 Tests
Human Bcl2 Associated X Protein (Bax) ELISA Kit
Sign In for Pricing
View Details RDR-Bax-Hu-02 48 Tests
Human Bcl2 Associated X Protein (Bax) ELISA Kit
Sign In for Pricing
View Details