Kbtbd5 Peptide - N-terminal region
Kbtbd5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
2310024D23Rik, Kbtbd5
UniProt
Q9D783
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Kbtbd5 Rabbit Polyclonal Antibody (orb577336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_082478
Preservative
Lyophilized powder
AA Sequence
LGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRVGEREFPCHRLVLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2474-500 1x 500 µL
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472244-500 1x 500 µL
Heat Shock 27kDa Protein 1 (HPS27) (CPTC-HSPB1-2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details