Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP660 Peptide - C-terminal region

ZFP660 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm8008, EG623911, EG666257, Znf660 Gm8008

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP660 Rabbit Polyclonal Antibody (orb324827) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001477566

Preservative

Lyophilized powder

AA Sequence

QVILHLRTHTKEKPYKCSECGRAYRYSSQLIQHQRKHNEEKGTLLFTSQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM206 siRNA (Mouse)
orb1842380-01 15 nmol

TMEM206 siRNA (Mouse)

Sign In for Pricing
View Details
TMEM206 siRNA (Mouse)
orb1842380-02 30 nmol

TMEM206 siRNA (Mouse)

Sign In for Pricing
View Details
PE/Fire™ 700 anti-human CD127 (IL-7Rα)
GT12877 25 Tests

PE/Fire™ 700 anti-human CD127 (IL-7Rα)

Sign In for Pricing
View Details
Mouse Intercellular Adhesion Molecule 2 (ICAM2) ELISA Kit
DL-ICAM2-Mu-01 48 Tests

Mouse Intercellular Adhesion Molecule 2 (ICAM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Intercellular Adhesion Molecule 2 (ICAM2) ELISA Kit
DL-ICAM2-Mu-02 96 Tests

Mouse Intercellular Adhesion Molecule 2 (ICAM2) ELISA Kit

Sign In for Pricing
View Details
PAXIP1 (PAX-interacting Protein 1, PAX transactivation Activation Domain-interacting Protein, PAXIP1, PAXIP1L, PTIP) (MaxLight 650) discontinued
302636-ML650 100 µL

PAXIP1 (PAX-interacting Protein 1, PAX transactivation Activation Domain-interacting Protein, PAXIP1, PAXIP1L, PTIP) (MaxLight 650) discontinued

Sign In for Pricing
View Details