Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP660 Peptide - C-terminal region

ZFP660 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm8008, EG623911, EG666257, Znf660 Gm8008

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP660 Rabbit Polyclonal Antibody (orb324827) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001477566

Preservative

Lyophilized powder

AA Sequence

QVILHLRTHTKEKPYKCSECGRAYRYSSQLIQHQRKHNEEKGTLLFTSQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Interleukin-11 protein (IL11) (Active)
CSB-AP001801HU-01 10 µg

Recombinant Human Interleukin-11 protein (IL11) (Active)

Sign In for Pricing
View Details
Recombinant Human Interleukin-11 protein (IL11) (Active)
CSB-AP001801HU-02 100 µg

Recombinant Human Interleukin-11 protein (IL11) (Active)

Sign In for Pricing
View Details
Recombinant Human Interleukin-11 protein (IL11) (Active)
CSB-AP001801HU-03 500 µg

Recombinant Human Interleukin-11 protein (IL11) (Active)

Sign In for Pricing
View Details
Recombinant Thermoproteus tenax virus 1 Uncharacterized 6.8 kDa protein
MBS1071056-01 0.02 mg (E-Coli)

Recombinant Thermoproteus tenax virus 1 Uncharacterized 6.8 kDa protein

Sign In for Pricing
View Details
Recombinant Thermoproteus tenax virus 1 Uncharacterized 6.8 kDa protein
MBS1071056-02 0.1 mg (E-Coli)

Recombinant Thermoproteus tenax virus 1 Uncharacterized 6.8 kDa protein

Sign In for Pricing
View Details
Recombinant Thermoproteus tenax virus 1 Uncharacterized 6.8 kDa protein
MBS1071056-03 0.02 mg (Yeast)

Recombinant Thermoproteus tenax virus 1 Uncharacterized 6.8 kDa protein

Sign In for Pricing
View Details