Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abhd12 Peptide - C-terminal region

Abhd12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1500011G07Rik, 6330583M11Rik, AI431047, AW547313, RP23-241M12.2

UniProt

Q99LR1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abhd12 Rabbit Polyclonal Antibody (orb330395) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077785

Preservative

Lyophilized powder

AA Sequence

APSRSFRDFKVQFIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPERQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Axis Inhibition Protein 1 (AXIN1) Antibody (PerCP)
abx446481 100 µg

Axis Inhibition Protein 1 (AXIN1) Antibody (PerCP)

Sign In for Pricing
View Details
C5a protein
30R-2807 20 ug

C5a protein

Sign In for Pricing
View Details
Factor XII light chain Rabbit Polyclonal Antibody (BF750)
orb2553013 100 µL

Factor XII light chain Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
GR 94800 TFA
B8787-1 1 mg

GR 94800 TFA

Sign In for Pricing
View Details
DAXX Protein Lysate (Rat) with C-HA Tag
17666036 100 µg

DAXX Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
C330007P06Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4532702 1.0 µg DNA

C330007P06Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details