Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abhd12 Peptide - C-terminal region

Abhd12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1500011G07Rik, 6330583M11Rik, AI431047, AW547313, RP23-241M12.2

UniProt

Q99LR1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abhd12 Rabbit Polyclonal Antibody (orb330395) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077785

Preservative

Lyophilized powder

AA Sequence

APSRSFRDFKVQFIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPERQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubl5 Peptide - N-terminal region (AAP56285)
AAP56285-100UG 100 µg

Ubl5 Peptide - N-terminal region (AAP56285)

Sign In for Pricing
View Details
High Density Lipoprotein (HDL) Depletion Column (IgY Kit)
GWB-HDLIGY 1 Kit

High Density Lipoprotein (HDL) Depletion Column (IgY Kit)

Sign In for Pricing
View Details
Anti-CATSPER2 Antibody
CTA2617-01 30 µL

Anti-CATSPER2 Antibody

Sign In for Pricing
View Details
Anti-CATSPER2 Antibody
CTA2617-02 50 μL

Anti-CATSPER2 Antibody

Sign In for Pricing
View Details
Anti-CATSPER2 Antibody
CTA2617-03 100 µL

Anti-CATSPER2 Antibody

Sign In for Pricing
View Details
Anti-CATSPER2 Antibody
CTA2617-04 200 µL

Anti-CATSPER2 Antibody

Sign In for Pricing
View Details