Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4galt3 Peptide - C-terminal region

B4galt3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC72586

UniProt

Q6P768

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B4galt3 Rabbit Polyclonal Antibody (orb579493) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001009539

Preservative

Lyophilized powder

AA Sequence

LLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGSSQAFRQEMLQRRPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSIP1 Peptide
orb2019830 100 µg

PSIP1 Peptide

Sign In for Pricing
View Details
Recombinant Salmonella eutS Protein (aa 1-111)
VAng-Wyb1065-50gEcoli 50 µg (E. coli)

Recombinant Salmonella eutS Protein (aa 1-111)

Sign In for Pricing
View Details
Human Growth Differentiation Factor 15 (GDF15) ELISA Kit
EKL62403 96 Tests

Human Growth Differentiation Factor 15 (GDF15) ELISA Kit

Sign In for Pricing
View Details
ADAMTS-5 Inhibitor
MBS3615215-01 5 mg

ADAMTS-5 Inhibitor

Sign In for Pricing
View Details
ADAMTS-5 Inhibitor
MBS3615215-02 10 mg

ADAMTS-5 Inhibitor

Sign In for Pricing
View Details
ADAMTS-5 Inhibitor
MBS3615215-03 25 mg

ADAMTS-5 Inhibitor

Sign In for Pricing
View Details