Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cryab Peptide - N-terminal region

Cryab Peptide - N-terminal region

Product Specifications

Product Name Alternative

AACRYA

UniProt

P23928

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cryab Rabbit Polyclonal Antibody (orb330536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037067

Preservative

Lyophilized powder

AA Sequence

RPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECT2 Antibody
E45M02569G-1 100 µL

ECT2 Antibody

Sign In for Pricing
View Details
LARP2 Protein Vector (Human) (pPM-C-HA)
26307022 500 ng

LARP2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
JHUEM-3 Cell Line
CSC-C6604J One Frozen Vial

JHUEM-3 Cell Line

Sign In for Pricing
View Details
LRIG3 Conjugated Antibody
orb1621085 100 µL

LRIG3 Conjugated Antibody

Sign In for Pricing
View Details
Tmprss7 (NM_001105882) Rat Tagged ORF Clone
RR205171 10 µg

Tmprss7 (NM_001105882) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Goat anti-PCBP1 (aa223-234) Antibody
MBS422514-01 0.1 mg

Goat anti-PCBP1 (aa223-234) Antibody

Sign In for Pricing
View Details