Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cryab Peptide - N-terminal region

Cryab Peptide - N-terminal region

Product Specifications

Product Name Alternative

AACRYA

UniProt

P23928

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cryab Rabbit Polyclonal Antibody (orb330536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037067

Preservative

Lyophilized powder

AA Sequence

RPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cinpanemab Biosimilar - Research Grade
ICH5439-5mg 5 mg

Cinpanemab Biosimilar - Research Grade

Sign In for Pricing
View Details
RAD18 antibody
MBS9413961-01 0.1 mL

RAD18 antibody

Sign In for Pricing
View Details
RAD18 antibody
MBS9413961-02 5x 0.1 mL

RAD18 antibody

Sign In for Pricing
View Details
P63 (TP63) Human Over-expression Lysate
orb1341298 100 µg

P63 (TP63) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal Leukotriene A4 Hydrolase/LTA4H Antibody (457) [Biotin]
NBP2-89376B 0.1 mL

Rabbit Monoclonal Leukotriene A4 Hydrolase/LTA4H Antibody (457) [Biotin]

Sign In for Pricing
View Details
KDM3B Peptide - N-terminal region (AAP33022)
AAP33022-100UG 100 µg

KDM3B Peptide - N-terminal region (AAP33022)

Sign In for Pricing
View Details