Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bckdk Peptide - N-terminal region

Bckdk Peptide - N-terminal region

Product Specifications

UniProt

Q00972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bckdk Rabbit Polyclonal Antibody (orb581583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062117

Preservative

Lyophilized powder

AA Sequence

MILTSVLGSGPRSGSSLWPLLGSSLSLRVRSTSATDTHHVELARERSKTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cellular Apoptosis Susceptibility Protein (CAS) ELISA Kit
EKN51822 96 Tests

Human Cellular Apoptosis Susceptibility Protein (CAS) ELISA Kit

Sign In for Pricing
View Details
Picropodophyllin (Standard)
HY-15494R-01 5 mg

Picropodophyllin (Standard)

Sign In for Pricing
View Details
Picropodophyllin (Standard)
HY-15494R-02 10 mg

Picropodophyllin (Standard)

Sign In for Pricing
View Details
Picropodophyllin (Standard)
HY-15494R-03 25 mg

Picropodophyllin (Standard)

Sign In for Pricing
View Details
Picropodophyllin (Standard)
HY-15494R-04 50 mg

Picropodophyllin (Standard)

Sign In for Pricing
View Details
Picropodophyllin (Standard)
HY-15494R-05 100 mg

Picropodophyllin (Standard)

Sign In for Pricing
View Details