Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN10 Peptide - N-terminal region

CAPN10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NIDDM1, CANP10

UniProt

Q9HC96

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN10 Rabbit Polyclonal Antibody (orb330686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075571

Preservative

Lyophilized powder

AA Sequence

RRPQEICATPRLFPDDPREGQVKQGLLGDCWFLCACAALQKSRHLLDQVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protocadherin beta 3 (PCDHB3) (NM_018937) Human Over-expression Lysate
LS056132-20ug 20 µg

Protocadherin beta 3 (PCDHB3) (NM_018937) Human Over-expression Lysate

Sign In for Pricing
View Details
HAUS7 Antibody
orb1333396 100 µg

HAUS7 Antibody

Sign In for Pricing
View Details
TYMS Rabbit pAb
MBS8547900-01 0.1 mL

TYMS Rabbit pAb

Sign In for Pricing
View Details
TYMS Rabbit pAb
MBS8547900-02 0.1 mL (AF405L)

TYMS Rabbit pAb

Sign In for Pricing
View Details
TYMS Rabbit pAb
MBS8547900-03 0.1 mL (AF405S)

TYMS Rabbit pAb

Sign In for Pricing
View Details
TYMS Rabbit pAb
MBS8547900-04 0.1 mL (AF610)

TYMS Rabbit pAb

Sign In for Pricing
View Details