Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN10 Peptide - N-terminal region

CAPN10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NIDDM1, CANP10

UniProt

Q9HC96

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN10 Rabbit Polyclonal Antibody (orb330686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075571

Preservative

Lyophilized powder

AA Sequence

RRPQEICATPRLFPDDPREGQVKQGLLGDCWFLCACAALQKSRHLLDQVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ROCK1 (Thr455+Ser456) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-4630R-BF405-01 20 µL

Phospho-ROCK1 (Thr455+Ser456) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Phospho-ROCK1 (Thr455+Ser456) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-4630R-BF405-02 100 µL

Phospho-ROCK1 (Thr455+Ser456) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Group XIIA sPLA2 siRNA (h)
sc-89136 10 µM

Group XIIA sPLA2 siRNA (h)

Sign In for Pricing
View Details
CD99 Polyclonal Antibody
A72930-100 100 µL

CD99 Polyclonal Antibody

Sign In for Pricing
View Details
SDU Protein Vector (Human) (pPM-C-HA)
PV128436 500 ng

SDU Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-ERBB1/EGFR/HER1 Reference Antibody (pimurutamab)
MBS9247090-01 0.1 mg

Anti-ERBB1/EGFR/HER1 Reference Antibody (pimurutamab)

Sign In for Pricing
View Details