Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IZUMO4 Peptide - C-terminal region

IZUMO4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IMAGE:4215339, C19orf36

UniProt

Q1ZYL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IZUMO4 Rabbit Polyclonal Antibody (orb582132) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034935

Preservative

Lyophilized powder

AA Sequence

SMRPRSSAFSWPGTHRATPAFLVSPALRCLEPPHLANLTLEDAAECLKQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3243), CF647 conjugate, 0.1mg/mL
BNC473243-100 1x 100 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3243), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant MEK1 (phospho T292) Antibody
RC-4930-01 50 μL

Recombinant MEK1 (phospho T292) Antibody

Sign In for Pricing
View Details
Recombinant MEK1 (phospho T292) Antibody
RC-4930-02 100 µL

Recombinant MEK1 (phospho T292) Antibody

Sign In for Pricing
View Details
Recombinant MEK1 (phospho T292) Antibody
RC-4930-03 1 mL

Recombinant MEK1 (phospho T292) Antibody

Sign In for Pricing
View Details
DPH2 (NM_001384) Human Over-expression Lysate
LY419990 100 µg

DPH2 (NM_001384) Human Over-expression Lysate

Sign In for Pricing
View Details
Hexahydro-1,3-isobenzofurandione
TRC-H294020-25G 25 g

Hexahydro-1,3-isobenzofurandione

Sign In for Pricing
View Details