Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IZUMO4 Peptide - C-terminal region

IZUMO4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IMAGE:4215339, C19orf36

UniProt

Q1ZYL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IZUMO4 Rabbit Polyclonal Antibody (orb582132) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034935

Preservative

Lyophilized powder

AA Sequence

SMRPRSSAFSWPGTHRATPAFLVSPALRCLEPPHLANLTLEDAAECLKQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLOD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G5]
TA803225BM 100 µL

PLOD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G5]

Sign In for Pricing
View Details
PDLIM1 (NM_020992) Human Over-expression Lysate
LY402823 100 µg

PDLIM1 (NM_020992) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human NCR3/NKp30 Protein (His Tag)
PKSH032786-01 10 µg

Recombinant Human NCR3/NKp30 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human NCR3/NKp30 Protein (His Tag)
PKSH032786-02 50 µg

Recombinant Human NCR3/NKp30 Protein (His Tag)

Sign In for Pricing
View Details
LATS1/2 (Ab-1079/1041) Antibody
8B8125-AAT 50 µg

LATS1/2 (Ab-1079/1041) Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR559221 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details