Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC7 Peptide - N-terminal region

CCDC7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BIOT2, BioT2-A, BioT2-B, BioT2-C, C10orf68

UniProt

Q9H943

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC7 Rabbit Polyclonal Antibody (orb325893) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078964

Preservative

Lyophilized powder

AA Sequence

EQTYQAAEKSQAHNEVPNERLVVEHQESLSKTKLQIKKQETSTEQPLTTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NMNAT3 activation kit by CRISPRa
GA117697 1 Kit

Human NMNAT3 activation kit by CRISPRa

Sign In for Pricing
View Details
ZC3H8 Mouse Monoclonal Antibody [Clone ID: OTI5D1]
CF808241 100 µg

ZC3H8 Mouse Monoclonal Antibody [Clone ID: OTI5D1]

Sign In for Pricing
View Details
1,4-Diazabicyclo[2.2.2]octane bis(Sulfur Dioxide) Adduct
TRC-D417603-10MG 10 mg

1,4-Diazabicyclo[2.2.2]octane bis(Sulfur Dioxide) Adduct

Sign In for Pricing
View Details
Phenylbutazone-d9
TRC-P319572-25MG 25 mg

Phenylbutazone-d9

Sign In for Pricing
View Details
CSDE1 Human Gene Knockout Kit (CRISPR)
KN207101RB 1 Kit

CSDE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (AE-2), CF594 conjugate, 0.1mg/mL
BNC940946-100 1x 100 µL

Double Stranded DNA (dsDNA) (AE-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details